0332.238.80.80
  0554 708 80 80
Kategoriler
Organik Gıdalar
Para Birimi Seçimi
  • Organik%20Tahin%20Çifte%20Kavrulmuş%20
  • Organik%20Tahin%20Çifte%20Kavrulmuş%20
  • Organik%20Tahin%20Çifte%20Kavrulmuş%20
Organik Tahin Çifte Kavrulmuş
Ürün Kodu : 645
129.00 TL   +Kdv
Yeni Sezon Ürünü
Gramajlar
240gr


Bu ürün Organik ve sertifikalı olup 5262 sayılı Organik Tarım Kanununa 18/08/2010 tarihli ve 27676/2010 numaralı ORGANİK TARIMIN ESASLARI VE UYGULANMASINA İLİŞKİN YÖNETMELİK ’e uygun olarak üretilmiştir.


https://www.anadolununozu.com/kurumsal/organik-urun-sertifikalarimiz

Organik Çifte Kavrulmuş Tahin – Organic Double Roasted Tahini

Mevsiminde özenle toplanan ve seçilen Kabuklu susamdan  elde edilmiş  geleneksel yöntemlerle odun ateşinde katkısız organik olarak üretilmiş ve paketlenmiştir. Taze ve zamanında hasat edildiğinden içinde bulunan vitaminler ve faydalı diğer elementler korunur. Türk Gıda Kodeksine uygun olarak üretilmiştir. İçerisinde Hiçbir koruyucu ve katkı maddesi içermemektedir. Güvenerek alabilir, tüketebilirsiniz. Tavsiye ederiz.

Organik ve sertifikalı ürün olup 5262 sayılı Organik Tarım Kanununa 18/08/2010 tarihli ve 27676/2010 numaralı ORGANİK TARIMIN ESASLARI VE UYGULANMASINA İLİŞKİN YÖNETMELİK ’e uygun olarak üretilmiştir.

Tahinin Faydaları Nelerdir?

Tahin içerdiği pek çok vitamin, mineral ve yağlar sayesinde beyin gelişimini destekler, bağışıklığınızı ve kemiklerinizi güçlendirir, kalp ve damar sağlığınızı korumaya yardımcı olur. Bunların yanı sıra kolesterol seviyelerinizi düşürür ve cildinizi güzelleştirir.

Besin Değeri

Tahin, protein, lif, B vitaminleri (B1, B2, B3), E vitamini, demir, magnezyum, fosfor ve çinko gibi birçok önemli besin maddesi bakımından zengindir. Bu, vücuda birçok önemli besin öğesi sağlar.

Kalp Sağlığına Faydası Nedir?

Tahin, doymamış yağ asitleri bakımından zengindir. Bu yağlar, kalp sağlığını destekler ve kardiyovasküler hastalık riskini azaltır.

Kemik Sağlığına Faydası Nedir?

Tahin, kalsiyum, fosfor ve magnezyum gibi mineraller açısından zengindir. Bu mineraller, kemik sağlığını destekler ve osteoporoz riskini azaltır.

Mide Sağlığına Faydası Nedir?

Tahin, içerdiği yüksek miktarda protein ve mineraller sayesinde mide ülserlerinin iyileşmesine yardımcı olabilir. Protein, mide zarının onarılmasında önemli bir rol oynar. Ayrıca mide asidini dengeleyerek mide ekşimesi ve reflüyü hafifletebilir.

Bağırsak Sağlığına Faydası Nedir?

Tahin, bağırsak sağlığı için önemli olan lifleri içerir. İçerdiği lifler sayesinde kabızlığı önler.

Tahin Günlük Ne Kadar Tüketilmelidir?

Tahin, sağlık açısından faydalıdır, ancak dikkatli tüketilmelidir. Genellikle günlük olarak 1-2 yemek kaşığı tahin tüketmek, sağlık için uygun bir miktar olarak kabul edilir. Günlük 2 yemek kaşığı (30 gr) geçilmemek koşuluyla, yaş, cinsiyet, fiziksel aktivite düzeyi ve bireysel beslenme ihtiyaçları göz önüne alınarak bu miktarı ayarlayabilirsiniz. 

Tahin Pekmez Faydaları Nelerdir?

Tahin pekmez, tahin ve pekmezin karışımından elde edilen bir lezzet kombinasyonudur. Halihazırda her biri birbirinden faydalı olan ikili, birlikte tüketildiğinde şaşırtıcı faydalar sunar:• Yüksek enerji içeriğine sahiptir. İçeriğinde bulunan karbonhidratlar ve doğal şekerler, vücuda hızlı ve uzun süreli enerji sağlar.• Tahin pekmez, demir açısından zengindir. Demir, vücutta oksijen taşınmasında ve hücresel metabolizmada kritik bir rol oynar. Özellikle demir eksikliği riski taşıyan bireyler için iyi bir demir kaynağıdır.• Tahin pekmez, susam tohumlarının ve pekmezin besin değerlerini bir araya getirir. Bu, vücuda çeşitli vitaminler, mineraller ve antioksidanlar sağlar.• İçeriğindeki vitaminler ve mineraller, bağışıklık sisteminin güçlendirir. Bu, hastalıklara karşı direncin artmasına yardımcı olur.• Tahin pekmez, kalsiyum ve fosfor gibi mineralleri içerir. Bu mineraller, kemik sağlığını destekler ve osteoporoz riskini azaltır.• Doğal olarak bulunan bitkisel steroller, tahin pekmezde bulunur ve kolesterol seviyelerini düşürmeye yardımcı olabilir.• Pekmez, antioksidanlar bakımından zengin bir kaynaktır. Bu antioksidanlar, hücresel hasarı önlemeye ve vücudu serbest radikallerin zararlı etkilerine karşı korumaya yardımcı olur.

Tahinin Zararları Nelerdir?

Tahin genellikle sağlıklı bir gıda olmakla birlikte, susam tohumlarına alerjisi olan kişilerde ciddi komplikasyonlara sebep olabilmektedir. Ayrıca içerdiği yüksek yağ oranı ve kalori sebebiyle tüketilirken dikkatli olunmalıdır. Bu nedenle eğer düzenli tüketilecekse dengeli bir diyetle beraber tüketilmelidir.

Ürünle ilgili daha ayrıntılı bilgi ve iletişim için info@anadolununozu.com  'a mail atabilirsiniz.

Uyarısı : Ürünümüzde tespit edilmiş alerjen riski yoktur.

Bilgilendirme: Tüm Ürün açıklamalarımız  genel bilgilendirme için tasarlanmıştır. Kesinlikle tıbbi yardım, tıbbi tanı, ya da tıbbi tedavi amaçlı değildir. Firmamız ürünlerinde İlgili yasa ve yönetmelikler gereği bitkisel destek ürünleri ile ilgili, hastalık adı veya endikasyon belirterek tanıtım yapılmamaktadır. Ürünlerimiz ilaç değil; bitkisel takviye niteliğindedir. Firma olarak tüm ürünlerimizde yaptığımız indirim fiyatları, kampanyalı satış fiyatları bayi ve tüm mağazalarımız'da  geçerli değildir.





Aç karnına tahin tüketmek genellikle mideye iyi gelmez. Tahin yüksek yağ içeriği nedeniyle sindirim sistemi üzerinde ağırlığa sebep olabilir. Özellikle mide hassasiyeti olan kişiler aç karnına tahin tüketiminden kaçınmalıdır. Ancak düşük miktarlarda ve dengeli bir şekilde tüketildiğinde tahin sağlıklı bir diyetin parçası olabilir. Her zaman olduğu gibi herhangi bir diyet değişikliği yapmadan önce bir sağlık profesyoneli ile konuşmak önemlidir.

Aşırı tahin tüketiminin kilo artışına yol açabileceği göz önünde bulundurulduğunda günde en çok 2 yemek kaşığı tüketilmesi önerilir.




 

Bu ürün için taksit yapılmamaktadır.
Ürün Etiketleri
pekmeztahinpekmeztahinhelvasıtahinfaydalarıtahinkalorihelvatahinhelvatahinnasılyapılırtahinpekmezkaloritahinpekmezfaydalarıtahinnedirtahinfiyatlarıtahinfiyattahinnedemektahinpekmezkaçkalorifırındatahinhelvasıtahinhelvasınasılyapılırtahinn
BENZER ÜRÜNLER
Yeni Sezon Ürünü
  
  
Organik Kabuklu Tahin(Çifte Kavrulmuş)
E-Bülten
İndirimli ürünler ve fırsatlardan ilk önce siz haberdar olmak istermisiniz?
softtr® | Profesyonel E-Ticaret Sistemleri ile hazırlanmıştır.